PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001573m
Common NameCARUB_v10001573mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 301aa    MW: 34049.2 Da    PI: 7.898
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001573mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.4e-143481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l ++    G g+W+ +a+  g+ R++k+c++rw +yl
  Carubv10001573m 34 KGLWSPEEDSKLMQYMLSNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 81
                     678*******************************************97 PP

2Myb_DNA-binding48.71.7e-1587130146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+++ +  lG++ W+ Ia++++ gRt++++k++w++
  Carubv10001573m  87 RGAFSPQEEDLIIRFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 130
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8422981IPR017930Myb domain
SuperFamilySSF466891.13E-2732128IPR009057Homeodomain-like
SMARTSM007172.0E-103383IPR001005SANT/Myb domain
PfamPF002492.3E-133481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-223588IPR009057Homeodomain-like
CDDcd001672.82E-83781No hitNo description
PROSITE profilePS5129424.44982136IPR017930Myb domain
SMARTSM007172.3E-1586134IPR001005SANT/Myb domain
PfamPF002491.8E-1487130IPR001005SANT/Myb domain
CDDcd001671.93E-1089129No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2589137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
RNNLTTQTKK KRKMRKPEVA IAASTTHQVK KMKKGLWSPE EDSKLMQYML SNGQGCWSDV  60
AKNAGLQRCG KSCRLRWINY LRPDLKRGAF SPQEEDLIIR FHSILGNRWS QIAARLPGRT  120
DNEIKNFWNS TIKKRLKKMS DTSNLINNSS SSPANTASDT SSNSTSSLEL KDIIGSFMSL  180
QEQGFVNPNS LTHHMPTNNP FPAPNMISHP CNDDFITYAD GIYGVNAGVQ GELYFPPLEC  240
DQESDWYNAN INNHLEELNT NGSGNEPDQG MIRPVEEFWD IDQLMNTEVP SFYFNFKQSI  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27321365108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0004550.0BT000455.1 Arabidopsis thaliana putative transcription factor (MYB46) (At5g12870) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288326.10.0hypothetical protein CARUB_v10001573mg, partial
SwissprotQ9LXV21e-173MYB46_ARATH; Transcription factor MYB46
TrEMBLR0GWC90.0R0GWC9_9BRAS; Uncharacterized protein (Fragment)
STRINGscaffold_601291.11e-171(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-168myb domain protein 46